CJC-1295

Also known as: Modified GRF 1-29, Mod-GRF

Growth Hormone PeptidesExperimentalSubcutaneous

A synthetic analog of growth hormone-releasing hormone (GHRH). Available with or without Drug Affinity Complex (DAC) which extends half-life.

Molecular Weight

3367.9 Da (no DAC) / 3647.3 Da (with DAC)

Half-Life

30 min (no DAC) / 6-8 days (with DAC)

Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Mechanism of Action

Stimulates pituitary gland to release growth hormone in a pulsatile, physiological manner. Preserves natural GH feedback loops.

Dosing Protocol

No DAC: 100 mcg 2-3x daily (before bed, AM, post-workout). With DAC: 2mg once weekly.

Open peptide calculator

Reconstitution

2mg vial + 2mL BAC water = 1000 mcg/mL.

Storage

Lyophilized: -20°C. Reconstituted: 2-8°C.

Side Effects

●Flushing
●Headache
●Water retention
●Tingling/numbness

Key Research Findings

●Sustained GH elevation for 6+ days (with DAC)
●Increased IGF-1 levels by 50-70%
●Improved body composition in clinical studies

Research Use Only

This information is provided for educational and research purposes only. It is not intended as medical advice. Always consult a qualified healthcare professional before using any research compounds.