Back to database

LL-37

Also known as: Cathelicidin, CAP-18

Immune SystemExperimentalSubcutaneous

A human cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, viruses, and fungi. Also modulates immune response.

Molecular Weight

4493.3 Da

Half-Life

~4-6 hours

Sequence

[LL-37, 37 aa]

Mechanism of Action

Disrupts microbial membranes, neutralizes bacterial endotoxins (LPS), promotes wound healing, modulates TLR signaling, and recruits immune cells.

Dosing Protocol

50-100 mcg subcutaneous daily. Often cycled 4-6 weeks.

Open peptide calculator
Reconstitution

5mg vial + 2mL BAC water = 2500 mcg/mL.

Storage

Lyophilized: -20°C. Reconstituted: 2-8°C.

Side Effects
  • ●Injection site redness
  • ●Mild inflammatory response
Key Research Findings
  • ●Broad-spectrum antimicrobial activity demonstrated in vitro
  • ●Anti-biofilm properties against MRSA and Pseudomonas
  • ●Immune modulation in chronic infection models

Research Use Only

This information is provided for educational and research purposes only. It is not intended as medical advice. Always consult a qualified healthcare professional before using any research compounds.