Sermorelin

Also known as: GRF 1-29, Geref

Growth Hormone PeptidesPreviously FDA Approved (discontinued commercially)Subcutaneous

The first 29 amino acids of GHRH. Stimulates natural GH production and release from the pituitary. Considered a more physiological approach than exogenous GH.

Molecular Weight

3357.9 Da

Half-Life

~10-20 minutes

Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGES

Mechanism of Action

Binds GHRH receptors on pituitary somatotrophs, stimulating GH synthesis and secretion while preserving natural pulsatile release patterns.

Dosing Protocol

200-300 mcg subcutaneous before bed. Daily use for 3-6 months.

Open peptide calculator

Reconstitution

2mg vial + 2mL BAC water = 1000 mcg/mL.

Storage

Lyophilized: -20°C. Reconstituted: 2-8°C.

Side Effects

●Injection site irritation
●Flushing
●Headache
●Dizziness

Key Research Findings

●Restored youthful GH pulsatile patterns in aging adults
●Improved sleep quality in GH-deficient patients
●Increased lean body mass in clinical studies

Research Use Only

This information is provided for educational and research purposes only. It is not intended as medical advice. Always consult a qualified healthcare professional before using any research compounds.